dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PITG_19150 (Phytophthora infestans T30-4 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | PITT_19150 | Phytophthora infestans predicted protein (translation) (374 aa)
Sequence length 374
Sequence
MIGLHTDCAVMNTLLRQNDVELHSHLNELGLNMEILCTKWLVTCFLTSLPTFCGLKVIDM
LLARSKEKQRASRVLLGVGISIFFTLRETLLDAKDAGEVLLAINEYFAREMTKTTVEMDK
FLHFCLIITDQLEPDIVEEFRLVHKDEVMERFAAFEAKKIEMRQQLEEAKAKQRKVASAP
PSPSKTERLSTLSASGIASGKSNGNNRISGLSSYISNPLRSSGGSKTTGAGDDKESHKRY
QRVDVLQAHHSFSEDLEKMEDQLEDLADLFVRGKIDEKEHSCIRAQIVRKWCKGMNSPQS
AMVRVQCVKHTYCERSGGDGCTNSAPGLLEGPVRNSFTGEAEGAHRGRKGSISLYGRMKK
AQKSALAIFKSTFE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]