dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|197124622|ref|YP_002136573.1| (Anaeromyxobacter sp. K)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment NUDIX hydrolase [Anaeromyxobacter sp. K]
Sequence length 219
Sequence
MRAPGFDEATERVRRALAARPRRALAVPGFRPAAVLVALLDRAGGPSILFTRRSQALEHH
RGEISFPGGRLEPGEDARAAALREAHEEVGLAPAASEVLGLLDDLPSVAGYVVTPVAASV
RAPPAAFTASAGEVDEHFELPLAQLLDPALRRASLWDPAGLPERLAAVVARAAVPFEDVD
PGTGHWRVWSFHADEARVVWGLTARILADLLDRAFAARG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]