dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|307352506|ref|YP_003893557.1| (Methanoplanus petrolearius DSM 11571)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Mpet_0345 [Methanoplanus petrolearius DSM 11571]
Sequence length 425
Sequence
MKRINIFLILLVLFAAIPFIAAADDSEDSSYTDVTVTSVEYDPEVFMPGDEGTITITVKN
TGDESVTISRAEIYSQDVTNLNDEAYDTVGALGAGNSMEFTFNVKAPLKEGIYYPRFYLD
FYGSSGLSYNVPVKVDDTGLTISVINSPDAWQEDVSKSIQIRVGNPSQVTADGVIIYASG
DGIESDQTSFFVGALEPNEYVDVTFEITPSKETTLKLNAEWNNGMNSHTSEISVPVEFGE
DTTGADLVINNVEVSGGTVTGDVSNAGLEDAYSVIVTVGSPAEAIEPYKQYVLGSLESDD
FSSFEVTYSIQGSSSSFPLVITWKDENGNTYSSEYTVSASSSGMAVEGDDSASSGGAPSG
MGSGGPSGGGMGMMGMSGAGFANMPIAEIIIGLIIVIGLVVAWKKGYLAKAVKVVKEKLN
KGDRK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]