dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|310817768|ref|YP_003950126.1| (Stigmatella aurantiaca DW4/3-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase, s1a (chymotrypsin) subfamily [Stigmatella aurantiaca DW4/3-1]
Sequence length 392
Sequence
MSNPVTVSAASNPLTRRKSWALIASMGAALAAGCGPEAAPETQATLGEASQEIVGGTNAA
ITDFPWQISFQSSSGSHFCGGSIIDANWILTAQHCVYEAANSPSHPSTVRVGAGSATRTG
QVQIKQITDIIPYPGYSDATLGKDVALLRLSSPLTFNTSVKAIPLATAADVSAGRTDPGV
VSTVTGWGTTSSGSSSLPTTLQKVDVPVVSNATASANYGMTITADQIAAGYAAGGKDSCQ
GDSGGPLVVNGASGKILAGVVSWGEGCALPNYPGLYARVSSFQPWINGIITKTPSSLLSQ
TGASAGSKAWKHYTITVPAGVSALTVAASGGSGDADLYVHTSTPTTSAYTCRPYASGNTE
YCSIGSPRAGTWYVSLYGYTAASGVTLKATAY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]