dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|310821131|ref|YP_003953489.1| (Stigmatella aurantiaca DW4/3-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase s8 and s53 subtilisin kexin sedolisin [Stigmatella aurantiaca DW4/3-1]
Sequence length 729
Sequence
MERGQRDGPGTVRTGRQRSAGPLYAFHLIQGASRMNRFIGSLWLQALTATSALGVAAVGR
PAEAAGRVELNALQAEGQYNRFIVKYREDSAEFAQPESVQRHLDATTQRAVALKGAAPLV
LGHVRRLAVGADVVSVDRKLDRTGAETLMREIAADPNVEYVEVDRLNKPFATPNDTRYGE
QWHYFDAVGGLNLPPAWDLATGSGVVVAVLDTGITNHSDLNANVVPGYDFIVDTAVAGDG
NGRDADPSDPGDFEGGYSSSWHGTHVAGTIAAVTNNSKGVAGVAYGAKISPVRVLGRGGG
YDSDISDAIIWASGGSVSGVPANANPAKVINLSLGGSGSCGSTSQSAINAAVGRGTVLVI
AAGNSNANVSGFSPANCNNVIAVAANGKTGARASYSNYGSLIDVTAPGGDGSYGILSTLN
TGSTTPGSETYDGTYQGTSMAAPHVAGVVALIQSVASKTPAEIETILKSTARALPGSCTG
GCGAGIVDAYAAVQAAKGGGNPNPPGDNVLTNNVPVTGLSGSANTELRYTLAVPAGSSNL
TIATSEGTGDADIYVKFGSAPTTTSYDCRPYKSGNVESCAFATPQTGTYHVMVRGYSTFS
GVKLLGSYTAGSGGGGQSFFENTTDFSILDKATIESPITVSGRTGNAPSTLKVSVSIYHT
YQGDLKVDLIAPDGSVYVLHNYTGSGTDNIITTYTVNASSEVANGTWKLRVNDKAAGDTG
YLDKWSLQF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]