dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|310822199|ref|YP_003954557.1| (Stigmatella aurantiaca DW4/3-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein STAUR_4952 [Stigmatella aurantiaca DW4/3-1]
Sequence length 424
Sequence
MWSTLRTVVALAGCVFVPVEAQAQFGQCGMDAISQADAANRVEWARRCALNKLATVQGFA
VTDGANPMIDYQEVDPLTNPSGQNAFHGDISNFEINGTYAYALFAGMPSSQVLDAYGFYQ
WTSTHRRPNPYYPLFGTTPTPGAGSQLYPHPQLKDCNLYTDRSGYNAAPTFYVNMYCNST
SAALSNGVPVSGLTHSAGGEKHFTVAIPEGSVGLSIALSGGTGNADLYIKRGAVPTEASY
DCASRSSGNYDSCYVAAAEGTYYVLVKGVVGYSNLSVTARWNALARYSPVSNLYAGLGTE
KLYTFYVPGNVSSATFSLSGGTGDADLYVRYGAAPTLTEYNCRPYTGGSTETCTFSYPSA
GTYYVMVRAWSRFSGVTLSANYVEMPPEPPSCLQQAVCPANMACPIPVPCLAEEEAPASQ
PVRY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]