dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|332796608|ref|YP_004458108.1| (Acidianus hospitalis W1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment FHA domain-containing protein [Acidianus hospitalis W1]
Sequence length 233
Sequence
MTWKCPICGYENSDDALFCMQCGAKKPENVKTEPPAVQQEANQQPPISAQPSAEPQAQQV
QAQEQSSQPVVVTEQSNQQLTSEGQSSVQTSVKQPIEQSVQQTSQTPSQSVSVGSATQQT
LQTPAGKYYLIFIATPVSALNKTKLPLEFDVFESISIGRSPENVIVIPDPEISRRHAIIS
LEGGKLYIEDLNSTNGTYLYDGKLFQPVKGKQELAPGSIIKLGSNTMLKIVIE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]