dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|389861214|ref|YP_006363454.1| (Thermogladius cellulolyticus 1633)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment membrane-bound hydrogenase, subunit NuoCD [Thermogladius cellulolyticus 1633]
Sequence length 538
Sequence
MGGKLIQEKTKVSRDALLDSIRLFMEQGFSNIVAITGVDRKDNIELIYHLGDEHGGMVHL
SVQLPKGDPVVDDISSLKPGAKILEREVHDLFGVEFWGFDELDKKRLLLPECYPEKASPP
LLKDVDSDTFKKYIGDPMACAYEALTLSAPLSPESALVPIGPYHPALKEPEFFSLVVEGE
RIKKAFVRIGFVHRGIEKLAESRTYIKDIFLFERVCGICSTHHAWTFVEAVEKLLNVDPP
PRAQYLRTLIAELERIHSHSLWLGLIGYWIGFESMFMWVWGLRETVMDLFEELTGNRVHK
SFITIGGVRMDISDEKVKKAAAKVSEFEKQIDSVMETVMSSDLFIERSKGIAKYTLEEAR
AFSAVGPVRRAAGDPYDIRRIEPYGAYGELDFEVRTTKTGDVYNLVLLRLGEIKESARII
RQIAEKIPSGNPVPPKPFLGVVKEGEAYARTEAPRGELFYYVNSNNTAYPYRVKVRTPTL
LNIQLAAHLLEGATLSDFPVIVTSIDPCFSCMDRVLVYDERAGCAKIISAEEIGRKRM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]