dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|383487210|ref|YP_005404890.1| (Rickettsia prowazekii str. GvV257)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment protein transport protein SEC7 (sec7) [Rickettsia prowazekii str. GvV257]
Sequence length 458
Sequence
MDSLLKNEVIKLFNDKPKSGIARIKKWCTDNNQDFIAETAKIFYEEKSNLNLEFVGDYLG
TDGVDNQKVLESFTKQFDFKEKDYLESLRRFLQSFKLPGEAQKIDRLVESFGTHYYEQNL
NIDINSKDAAYILAYQTIMLNTDLHNPSIAKSKKMTFEQLKNNLKGTNESKNFNDNFLKK
IYDEIEAKPFKLNFVDSSPGYQINNISSQNDKTFKQLNQFLEEKRNIQNIFPKLQNNNLT
IEFKNPKTFLSKFTGYKGSVIIKDEKSGAAEIQVYKPSIFSRWFLGEKSKIIIQPLREEG
RQPSEQSLKLAAQITASFETKVTSIKATYDYLKEDLKSQYDNIRNPKKELEKASAIAEGH
KNIKYITEIVHQINQPVKNAVAVFSSTISVEPQISKSDLPIKPPQLPVPKSIPNVVKKAA
KDISKQISHERDKHKEELAKALEIQRRKIEKQNSGRVV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]