dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|118576718|ref|YP_876461.1| (Cenarchaeum symbiosum A)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment RNase PH-related exoribonuclease [Cenarchaeum symbiosum A]
Sequence length 270
Sequence
MVHVTVIDELKRAKIAALLERGERIDGRRLDEPRKLTIETNAIPKAEGSARVHLGRTDVV
TGVKVQPDRPFPDVGDRGIFICTAEILPLAHPDVETGPPSPAVIELARVVDRGIRESGMV
DLSKLVLLKDKSVIGIFADSSVIDVDGNLFDACSYAATAAILTAKLPKWEIQDEAPVRIE
GETPVPVTTIPVSVTMAKINGHILVDPNQDEWAVMDARITITTNSDGNICALQKGGNSGF
THAELVKCGEISVRVGADIREIIKRAGGGS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]