dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|197105175|ref|YP_002130552.1| (Phenylobacterium zucineum HLK1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment diguanylate cyclase [Phenylobacterium zucineum HLK1]
Sequence length 349
Sequence
MSSDVETSLRGPKAYALARKAIEAMEAHQVWPTALNFELWVHYVAAKDSALATEIDHLIE
AGEPFTDAVGEQLAAQFLPKAKLNGEILEAGQTLSKELDSVSRAIESARETSEAYGQQLA
SASESLDGEDAQAIKSMVETLTVATRKVREENHALESQLQDTTAELGRLREHLEQVRRDA
MTDALSGLANRKAFDEALERACDQGEQGGPVTLAVIDIDHFKSFNDTWGHQTGDQVIRYV
ASVIQRCSPAPRVSARYGGEEFAIIFPGESARDSLAVLEAVREEVSSRILKRRSTNEDLG
AITISAGIAERKPGESPASLVERADSALYASKRGGRNRTSCADPIAAAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]