dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSLAFP00000006463 (Loxodonta africana 69_3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel supercontig:loxAfr3:scaffold_2:33373616:33388294:-1 gene:ENSLAFG00000007690 transcript:ENSLAFT00000007689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 412
Sequence
MRACVPLIVAMLCGLAWAGTTESCASRCNEKFDRDAACQCDRRCPRHGDCCEDYEQLCTA
EENPKEPKAFLELEEETEEAPASNLYSAPSSCQGRCYEAVDKHHPCHCDARCQEFGNCCD
DFEILCGHEGFSHSSDAITKEELRSISEKIYKADTNKAQKADIVLNSQKRIPRSETRDRV
DCCPEPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQQLAEQDAFLREIMKTA
VMKELYGFLHHQNRYSSEQEFVNDLKNMWFGLYSRGNEEGDSSGFEHVFSGEVKKGKVTG
FHNWIRFYLQEKEGLVDYYSHIYDGPWDSYPDVLAMQFDWDGYYKEVGSAFIGSSPEFEF
ALYSLCFIARPGKVCQLSLGGYPLAIQTYTWNKSTYGNGKKYIATAYVVSST

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]