dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSMLUP00000000932 (Myotis lucifugus 69_2.0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:putative scaffold:Myoluc2.0:GL430596:174310:187682:1 gene:ENSMLUG00000001017 transcript:ENSMLUT00000001021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 808
Sequence
LRTGPGVGGRTPRHCAAKPNGSLSFVSGCPSYLRPRKRPWLHPVCHHADCQQLHRRGPLN
LCQACDSKFHSAMHYDGHVRFDLPPQGSVLARNVSTRSCPPRTSPAVDLEEEEESSVDGK
GDQRSRDQRLLKKKKARRRHTGPQAKECFTLKFLNVDIETEIVPGREEEGPWEVLLPIFE
RKGIALGKVDIYLDQSNTPLSLTFEAYRFGGHYLRVKAPAKPGDEGKVEQGVKDSKSLSL
PILRPAGAGPPGLERADPQSRRESLDILAPGRRRKNMSEFLGEASIPGQEPPAPSSCSLP
SGSSGGGNDSWKNRAASRFSGFFSSGPSASVFGREVDKMEQLEGKLHAYGLFGLPRLPRR
LRFDHDSWEEEGDEEEDEDDACLWLEDSWRDLIDGHEKLTRRQCHQQEAVWELLHTEASY
IKKLRVITNVSGAQSHPICSLWVPLSPRRVRTFAEGAVARPPSGKEASRAAPWVSPGPPH
LRFSHPHPQSHGRIFPHPGPDRRPFPGCPPREETLQLLLGGQPEDERRERTARCLLGGHP
RCAGAPCPAPACPCRVWATPFPGAPPGGEPVVSSAAQPGTDACTELVIHHAPCSPEPASQ
DFKVASQCSLSSLISSFNLNKSQVYSSMKENCLVLPFALPFNSALTFMAMRTGRGRCSGQ
MDVYCFLFTDLLLVTKAVKKAERTKVIRPPLLVDKIVCRELRDPGSFLLIYLNEFHSAVG
AYTFQASGQALCRGWVDSIYNAQNQLQQLRAQEHGGSQQHLQSLEEEEDEQEDEEEDEED
EEGGESSTSAASSPTILRKSSNSLDSQH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]