dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|330835349|ref|YP_004410077.1| (Metallosphaera cuprina Ar-4)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pantothenate kinase [Metallosphaera cuprina Ar-4]
Sequence length 247
Sequence
MVDVLIPLSVSGVWYPYLAEDLAQSGSIGITVLLEPFSYAKVGNGEGILINGEKVRLDNV
EYLSRKLGKVKVEIETGVPLGYGYGLSASISLAYALGASEIKGIDPYLAVLEAHKSEIIA
KNGLGDIVSQYFGKNIVYREKPGFPPYGVVRSFPIDSDNIYSLPIESLPTTTILKPLDVS
FELIQDFLQNPTLERFFSVSKRFTELLGFESKYPNSFRKKGLILKFGEPESESWIRHRIA
KRGAYVE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]