dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|313201074|ref|YP_004039732.1| (Methylovorus sp. MP688)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein MPQ_1333 [Methylovorus sp. MP688]
Sequence length 257
Sequence
MTPTAKQQVIQLLKSIETGEQAPVGYINAEKYIQHNLNVGDGLAGFGSVLQQLPKGSAKV
NTVRVLQDGDFVITHTEYDFFGPKIGFDIFRFEHGKIVEHWDNLQQTPAQANPSGHTMTD
GDKTIKDLEKTAANKKLVADFVDDVLVNGKLEKLASYFDGDHYIQHNPAIADGLSGLGAA
LKYLAEQGITMKYNRVHQVLGEGNFVLVISEGEFAGKWTSFYDLFRVQNGKIAEHWDTME
AIPPRQDWKNQNGKFGF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]