dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|54294840|ref|YP_127255.1| (Legionella pneumophila str. Lens)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment RalF protein, translocated into host cells by the Dot/Icm system [Legionella pneumophila str. Lens]
Sequence length 398
Sequence
MPSEIEKAQRDITEAFNAKPKNGIEKIKEICEENKISPNEEIAAFFHQQRKNLDLEAVGD
YLSGPEAENQQVLKAFTSQMDFNGQSFVEGLRTFLKTFKLPGEAQKIDRLVQSFSAAYSQ
QNPDVVSNADAAYLLAFQTIMLNTDLHNPSIPEKNKMTVDGLKRNLRGGNNGGDFDAKFL
EELYSEIKAKPFELNFVKTSPGYELNSTTLNKDSTFKKLNSFLYSTDANINTVFPGIGDN
VKTTVDQPKSWLSFFTGYKGTITLTDKQTSAQATIQVYTPNIFSKWLFGEQPRVIIQPGQ
TKESIDLAAKAAAGFSSPVKNFKATYDYEVGDLIKAYDNQKKLISPNKNMVIKGSIFRTP
NAEQRETSKSATRTVNTDYDINEDTVTRKDESRSSYKK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]