dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

LELT_00660 (Lodderomyces elongisporus NRRL YB-4239 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | LELG_00660 | Lodderomyces elongisporus hypothetical protein (375 aa)
Sequence length 374
Sequence
MNSELTKLTNQVCKKWKSVGDVVTKPNCHQVDWKAIKHTPQYLKLKIKYAGVSYTVDEDF
DKLENILKSQSVSLKKLIEQTKQFTSSMVDTIQNAIAVSKCFHDTIDPCSNAHSNVPIFG
DTYDKWANMVKYKQLVQAISIESEIVYLNNGTLKQLELLNNQILKQVFKMIRERRYAALD
CDKLSNEHKTLAEKQSNIGGADQLSSRETSHIFAIGRKLFDAKKKYNYYNALLKKELPSL
ILLIKPIISYATTDLYLLHLNYCYSWIIKLNNIPYKDVPMEKLLRDSETKQVELDAEVRG
LKLFTPMQKDGHTVCTQTNASWSCIALYDYDGLQDDDLTFKRNDTIKIIAKDNDNWWKGE
VKGKVGYFPSNYVF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]