dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|88602435|ref|YP_502613.1| (Methanospirillum hungatei JF-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment anti-sigma-factor antagonist domain-containing protein [Methanospirillum hungatei JF-1]
Sequence length 134
Sequence
MASPDVETDLIYTLKKEAGSALPIDIWYEGEMWIFHPIGSIDTTTSSDLEGTLIEGINQG
MRWIILDLTDVRYISSAGIRVFIAAAKTLKEKKGELLFSTPNKNVSDILRLSGLFKIFKV
YPDNAAAIRSFTVK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]