dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|91773658|ref|YP_566350.1| (Methanococcoides burtonii DSM 6242)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment A-macroglobulin like protein [Methanococcoides burtonii DSM 6242]
Sequence length 1403
Sequence
MKYNGVTKKGFCLLVLLSCILLAGCIGQDDGNVQTSSNEALSYDEGGTYSEEDEYLVLVP
KALFSGGESSVTMSAFLDDEPVSRGVEYTLTSAAGDIIPLVKAATSESGNNVAKFDVPDV
EEGSYTLTATPSGAESGFTTTVKVMQNNPIFIETDKPIYKPGQIIHVRLLSLNNNLIPVV
QNTTVEIADAKGVKIYKDDLVTNEYGVAFFDLPLASELNLGTWKVKATSGSSMSEVDIRV
EKYVLPKFDLETSTEKSWFLADEPITGTVSANYFFGKVVEGTVEVKASRYVGVWEEYSTS
TATLKDGNVEFTLPAVGYVAGTFGAGGQGSVMLNVTVTDTGGNSEESTELLTIAEHPFIM
QMIPESNSIKPGMPLQVLLVTKDPGGEPLEKEVTLVANFRDDNYNYEEIKETYTTETGIA
LVTLEIPEDAVSVELSAASEKVKASSTLNSVYSPSASFLHLSQVSEGIPEVGDVISFKVY
STNAGTVFYDVFANGRTVYSATSDEPQINILVTPQMSPSAKVVAYLINPNNEVSADSLPF
DVKFSTQVDLSTGFDEEMVAPGDAVSVELDAGTKSMIGLSIVDESVYALSEGRLNLKQVF
DELEIRFMEPRVEAHPQYFGYQTTAYDVLDDAGMIVLASGSLEIPRSQTNDAKFIDFAAA
VFEMDGMEVMDEAVMEMPREEAAMDDEADSGEQLAEVERVRQFFPETWIWMPEILTDDNG
LATLDLNAPDSITKWRLHAVSSGPEGIGISEAGLTVFQDFFIDPDLPYAVIRGEEFPVQV
QVYNYLDMPQNVKLTLSGAEWFELVGDDVVEVGVDANSVTHVSFTIRPTRVGVQTVELTG
QTTEKADAIRKTIIVEAEGVTREIVDNGILKNGTVELDATLPDAIVPDSEKVILSFTPSI
VAQTISGVDDLLGMPYGCGEQNMMLFSTDVEVLRYLKATGQQNPEVQAKALTFITTGYQR
ELTFMHSDGSFSAFGESDGEGSLWLTSFVLSQFSGARDLTTIDENIVREAAEWIGSYQKE
DGSWEAVGFVIHEDMMGGVSGTYALTAYVTLALDEYGYAAPIVMENARSYLEAELDKQDD
PYALAIGTLALQKLESDRADESMEKLLELAKEDENGVYWGYDDVMPEPYEYGGYGFHPIS
SKNVETTAYATLALIETNDPRASSSLKWIAAQRNSNGGFSSTQDTVMAFRALMTAAAVAG
RDVDATVTVSGDGVEIKGLRITSENYDVVNIIEVPEGVEVLEMELSGSGELNYQLVRRFN
VILPEIIEHEQIELDVEYDSTDVEVDDVVKVDVRLKYNGMPGIRGVIESSGMMIVDIAVP
TGFTPVGSSLEALKEDGTITRYEIAGRKIILYIDEMMPGEEMEFSLNMRAMFPVKAMVQE
SSAYSYYNPEVKAEVKGMNVTVV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]