dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|20092500|ref|NP_618575.1| (Methanosarcina acetivorans C2A)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence length 1881
Sequence
MINISNKYVIYILPILLILIFASTSSALPTVAHDTIRGEMYVSSTANWDSKYSTNNFDVP
NGTVIFARYYVGVWASSDTRASISTTFNGHAFETNPSYYSTEMGVTWIPYDVVDYVLPGE
TNTATIDSASWGDGRQYGSTLVVVLKNESKPEIECWVAEGCDWLHYGDYVGYEVDNSTTY
FNGTVDLSNVQSASLYSTHLTGYNYEDFNGKSLSSPANSVSGDYFDYIRWDNIKPSLVTE
NQTVLVSRGEDSYCSPVFHALSIEYKAPDLLPVNLTPFLVSADTENIMTANIENIGNKSS
QSFNVSLVVNGNVVDTQQVSELAAGDSITVEFHWKPDGSTDAYSLTVVVDPENIVIESEE
SNNKFTSLVGITSATTPVANFSADKTSGDVPLTVNFTDLSANSPTSWAWDFENDGIIDST
EQNPSYTYSTPGTYTVNLTATNAGGSNSTAKVGYITASTIIPVADFTANNTSGNMPFTVQ
FTDMSTNAPTEWLWDFGDSASSTEQNPVHTYTAAGKYTVKLTAANVAGNDSEEKTDYITA
YISPVANFTATPTSGSAPLAVSFTDQSTNAPTSWVWDFGDDTSSTSQNPTHTYSASGTYT
VILTATNIAGTNTTTKIGYITVSDFRPIWTSKSEWSINIGNGVIPCFADLDGDGDYDLLR
GDRAGVTYAYENTGNASNPVWAAKSEWNLPDIGDYATPCSVDLDGDGDYDLMIGAKSGVT
YAYENIGNASSPVWSRKTTWDVSNVGKYTAPCSADLDGDGDYDLMIGEYYGTSYAYENTG
NKSSPEWTTKTTWNTPDVGYTSRQAIADLDGDGDNDLLIGNVYGYTYAYENTGTKSSPVW
AKKTTWDAPEIKNNAAPALADLDGDGDYDLLIGWASSGNSYAYENTAPLVGSKPDIIPTA
VTPPSGIVANTPCTIVATINNSGTGNTGTFNATLSVNGTVVDTQSISGISSDSSALVNFT
WTPEAAGNYSLIITADSENGIAESDEANNVLTVLVTVSAVSESPVANFTADVTSGTDPLT
VNFTDQSTGTPTSWFWDFGDGVNSTEQSPVHTYTAEGNYSVKLTVTNADGSDEGLKTDYI
TVSKSSIPVPEPVAAFTADVTNGSAPLTVNFTDQSTNSPTSWLWDFGDGANSTEQNPVHT
YSTEGTYSVNLTVTNEDGSDSELKTDYITVTQAGQVATNDLSISGIVNTVPASAVFARET
NPVKVLNVQNTGTATLSNISIAVYASDVSSGTVPVDTTTIASLAGDATTTVTLIDPTIRD
LEGGTVTYTAVVDPDNLIAETDETNNNKSSSAKPLRYNGYKGKGIYWEGGSNITTMHTFD
LQGNLLYSTQPDSAYQPVGWESRTETWTASDLPVPDGSTIEKAFLYVAYNWDQTPGGYPW
LNINFNGNALDNGNISTGNGTIYRDWSNFGAYADYEYGLCVYDVTDKFSSAGNSLVMTPV
GENKNALYPSTLVVVYGNDNETRKQIFINEECDELAYSLTGYGTTPEEATAYAPFTGMFI
DVEKVQNATLYSFAGSAGPEEGNLLFNGNIVATNAWQGSSNSGSPLVFDVKSYLNEAGNE
AGIQGTASGGMDALQQILVVEYPEETVAAPVANFSANVTEGEAPLPVQFTDQSTGTPTSW
FWDFGDGANSTEQNPVHTYSAAGNYTVNLTVENAAGTDFEVKSDYIEVTEASGSTVTLYF
DPASSSVSENESTEINLVASNFPAGLSGYNLTVSIDDPAIAEIVDIEYPSWALITQNSTL
PGTSIYMKTVDLEDSVKEGAADVVLATIKVSGKEKGSANLSIGVKRLEEDSGDPIEPALL
TGTIEVTLLSPLPDQEYAPKDLDGDGLYEDLTGNGEFSFVDIVAYFHNMDWIEENMPVEY
FDFNGNGRIDFDDVVDMFAMI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]