dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSMUSP00000039900 (Mus musculus 63_37 (longest transcript per gene))

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known chromosome:NCBIM37:3:87421497:87541955:1 gene:ENSMUSG00000041977 transcript:ENSMUST00000039476
Sequence length 1552
Sequence
MSIRLPHSIDRLSSLSSLGDSTPERTSPSHHRQPSDTSETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMRAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSIGVSGLQQNPSLSGGPRVNPMIPPPPPPPPLPPPQHITGPKPLQDPEVQKHATQ
ILRNMLRQEEKELQRICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGLVDVLPLC
GETSQRTCEGRLSVDSQEADSGLDSGTERFPSISESLVNRNSVLSDPGLDSPQTSPVILA
RVGQHHRRQGSDAAVHPLNHQGIDQSPKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSH
PAYLVVFLRYIFSQADPGPLLFYLCSEVYQQTNPKDSRNLGKDIWNIFLEKNAPLRVKIP
EMLQAEIDLRLRNSEDPRSALYEAQEAVMPEIQEQINDYRSKRTLGLGSLYGENDLLDLD
GDPLRERQMAEKQLAALGDILSKYEEDRSAPMDFAVNTYMSHTGIRLRESRPSSTAEKTQ
SAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILRYIGKPKSSSQSIKPGNVRNIIQ
HFENSHQYDVPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREEMKRSRKAENV
PRSRSDVDMDAAAEATRLHQSASSSASSLSTRSLENPTPPFTPKMGRRSIESPNLGFCTD
VILPHLLEDDLGQLSDLEPEPEVQNWQHTVGKDVVANLTQREIDRQEVINELFVTEASHL
RTLRVLDLIFYQRMKKENLMPREELSRLFPNLPELIEIHNSWCEAMKKLREEGPIIRDIS
DLMLARFDGPAREELQQVAAQFCSYQSVALELIRTKQRKESRFQLFMQEAESHPQCRRLQ
LRDLIISEMQRLTKYPLLLENIIKHTAGGTSEYEKLCRARDQCREILKFVNEAVKQTENR
HRLEGYQKRLDATALERASNPLAAEFKSLDLTTRKMIHEGPLTWRISKDKTLDLQVLLLE
DLVVLLQRQEEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSVATDKRAFFIICTSE
LGPPQIYELVALTSSDKNIWMELLEEAVQNATKHPGDAPVLNHPSPPGSQEPAYQGSTSS
RVEVNDSEVYPTEREPKKPSEGPGPEQRGQDKQLLAQEGPEQEEDAEELRALPCPPPSLD
GENRGIRTRDPVLLALTGPLLMEGLADAALEDVENLRHLILWSLLPGHTVKTQAAGEPED
DLTPTPSVVSITSHPWDPGSPGQAPAISDNTQFPRPEGSQPEGEDVALCSLAHLPPRTRN
SGIWDSPELDRNPAEEASSSEPAGSYKVVRKVSLLPGGGVGAAKVAGSNVTPALPESGQS
ESELSEVEGGAQATGNCFYVSMPAEPLDSSTEPPGTPPSLSQCHSLPAWPTEPPQHRGVT
GGQRSSLVLRDMGVIFHTIEQLTVKLHRLKDMELAHRELLNSLGGESSGGTTPVGSFHTE
AARWTDYSLSPPAKEALTSDPQNNQEQGSYPEEGSDTPLEDSATDTASSPGP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]