dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSMEUP00000014910 (Macropus eugenii 69_1.0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_2278:5:66176:-1 gene:ENSMEUG00000016294 transcript:ENSMEUT00000016350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 1576
Sequence
MEPGSVVRAIFDFCPSVSEELPLFVGDVIEVLEVVDEFWLLGKKEDVTXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEED
ENELGAYGALYKFALEPKELDFEVGDRIQILRTLEDGWLEGKLRGKTGIFPYRFVKLFPS
TTMGEAIDIPQESDQNKSPITPLSNLETSFVAHDERNKLHECDVEESTCTVSETSSLSLS
HLTFDCEEDKILYERESVGELPRSPERGCEGRLNKGFLNTDSTKPVNGIFSQTPILPQSS
KQKSLDFHTAAESHQSSEGCSNTLPSEAKDRDSPSVSIRETGSLPRTLGGLVSPLQSSSA
ASDSGLLKSNQLSPKLKDLATKNQQYKPREPSSSFSSISKDMEIQAGLQAKGTVTTAPVL
PQGEGSTDLDSKLTEQLAQFEKSLAVPKAELSKKISRHFSITDFSSEKDIVRGSPTLTTQ
QEPPGRRKVLRPPPPRPCAPASTPHLLVNQNLKPESPSFSMRPSRPAPLPPLAPQRMNLT
SVKSHPPSQLHCDTLEKENSSYLDKTLDSDSQCSFLLVRIQEMEQDLEEFSRTREELNLL
LEEKQDEELTAGTLENLEFCDYHIERLNMELQHLREMTLLSSQSASLQSPSVSVASEDPE
QRMLEKRAKVVEELLQTERDYVRDLEMCIEQIMVPLQQAQVQNMDFEALFGNIQMVVTVS
KQLLAALETTDTVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXSLYSEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKVPLANAVLAVK
EINVNINEYKRRKDLGKIGIIPKKEPVNILESICLTCSLVLKYRKGDEDSLMEKISKLNI
HSIIKKSNRVSSHLKHLTGFAPQIRDEAFEETEKNFRMQERLIKSFIRDLSLYLQHIRES
ACMKVLAAISMWDVCMEKGNGDLEKFEKVHRYISDQLFTDFKERTERLVISPLNQLLSMF
TGPHKLVQKRFDKLLDFYNCTERAEKLKDKKTLEELQSARNNYEALNAQLLDELPKFRHY
AQGLFSNCIHGYAEAHCDFVHRALQELQPLLTLLKVADREGNLIAVFHEEHSRVLQQLQV
FTFFPESLPVTKKPFERKTMERQSSRKPLQGLPSYMLQSDELRTTLLGKYPPEKLFQAER
NFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNSRRSHSD
ASVGSHSSTESEHSNSSPKFPRQSSNNALSINPGNVVADASGPLQQPTQSSALWQESGQE
NVHTSSNSVVPEEAPSRCLLDKDSPSQTRSWNPVDMVDLTRDVDQRTPAVRGYRHTSHPV
TVSQVVPRRNGQPRQGGDLLKGCSKMPPSVEDPNEELESVEAAGNQVYFAVYTFKARSPN
ELSVLANQKLRILEFK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]