dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

NP_001029431.1.59421 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment dual specificity protein phosphatase 18 [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence length 188
Sequence
MTASPCAFPVQFRQPSVSGLSQITSSLYISSGVAANNRLMLSSNRISTVINVSVEVVNAL
YEDIHYVQVPVADTPTSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLM
KYHAMSLLDAHTWTKSCRPIIRPNNGFWEQLIHYEFQLFGRNTVHMVSSPVGMIPDIYEK
EVRQMIPL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]