dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

NP_001179624.1.76553 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment USP6 N-terminal-like protein [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence length 831
Sequence
MRTEAVVNSQGQTGYLTKDSNQDVALKLAQERAEIVAKYDRGREGAEIEPWEDADYLVYK
VTDRFGFLHEEELPYHNAAMERQKHLEIERTTKWLKMLKGWEKYKNTEKFHRRIYKGIPL
QLRGEVWALLLEIPKMKEETRDLYSKLKHRARGCSPDIRQIDLDVNRTFRDHIMFRDRYG
VKQQSLFHVLAAYSIYNTEVGYCQGMSQITALLLMYMNEEDAFWALVKLFSGPKHAMHGF
FVHGFPKLLRFQEHHEKILNKFLSKLKQHLDSQEVYTSFYTMKWFFQCFLDRTPFTLNLR
IWDIYIFEGERVLTAMSYTILKLHRKHLMRLSMEELVEFLQETLAKDFFFEDDFVIEQLQ
ISMAELKRAKLDLPEPGKEDEFPKKPLGQLPPEGQSAGVTHLSNGQRSVGRSSPHPGGRR
GSGSPHKIHEPSPPHPRRTGTPERARQQRRKSSDEEGKRLRDEAQAQAQAQRRLPPGAQD
GSGQYNHAAANQNSNATSRARKEFAPRWHKPSEAAVLEKTAKSAVEGRSRAAPPALADPR
APHVRQKTKVLDADEGKRGSTASQYDNVPEDGPGGAVEEALERARAQSPRRPAEPGASPS
RAPPKFAFKVLPSSYAQHPFLPDGEDRGPAHPPSYSNPPTYQGSSPKRVPAANSSFPFPP
GAHTNPSRRPYGSTLSISASPEKSYSRPTPLVQPSSRIEVLPVDLGAGGYSGNSGSPKNG
RFILPPGDCLPDNRKWSEVGYTWRPEMHGQPWTRDVNRGHLSSFPRHPTFHHAPYQDHSL
PSVSVDGPVRYRTSPALEDATSPGFQYSGPSPPAYHYRNRDGLSMQESVLL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]