dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

NP_295624.1.55610 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein DR_1901 [Deinococcus radiodurans R1]; AA=GCF_000008565.1; RF=reference genome; TAX=243230; STAX=1299; NAME=Deinococcus radiodurans R1; strain=R1; AL=Complete Genome; RT=Major
Sequence length 162
Sequence
MFNTRKSALVIAALLSLGAPALAGTSSTQTDYDNATLSLSADGTYAQAVSFSVPSTTVTL
SAEQIRPGNSFTLSIPVTNTTDRDINVSAVAQAPSGTGAAHLKVSGVSTTATIKPGEDAT
LTFTLTFDNSTDAAQAGQTVQVVFDVSATANMNNTSSSGSSF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]