dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

NP_681221.1.97157 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ATP synthase F0F1 subunit C [Thermosynechococcus elongatus BP-1]; AA=GCF_000011345.1; RF=reference genome; TAX=197221; STAX=146786; NAME=Thermosynechococcus elongatus BP-1; AL=Complete Genome; RT=Major
Sequence length 99
Sequence
MISGNFVLSYYVSRKSTMNPLIASASVLAAALAIGLASLGPGLAQGNASGQALEGIARQP
EAEGKIRGTLLLSLAFMESLTIYGLVIALVLLFANPFAS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]