dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

NP_728507.1.81976 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment enhancer of bithorax, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence length 2669
Sequence
MSGRGSRKRGRPPKTPNERASGRFNYQLLKKPKYLSEGKSQPSTPSASRGISPQSDEGSR
SSHNNHTNRSRGSAAKRGRGRKSAVQPNTSSYSGRKGYESEYHYGSDFGDSEEDKSDNED
DMLLTPSDDESLEVANESESEFSVCSFNQNGVGRPPRPPSPEPVWLQEGRQYAALDLPDS
SEDLFIANTHVLRALSIYEVLRRFRHMVRLSPFRFEDLCAALACEEQSALLTEVHIMLLK
AILREEDAQGTHFGPLDQKDTVNISLYLIDSITWPEVLRSYVESDKTFDRNVFHILSHTE
YPYTGIDNRLEVLQFLSDQFLTSNSIRDVMLQEGPIHYDDHCRVCHRLGDLLCCETCPAV
YHLECVDPPMNDVPTEDWQCGLCRSHKVSGVVDCVLPQEKQGVLIRHDSLGVDRHGRKYW
FIARRIFIEDQENFTCWYYSTTSKLKLLLSRLDAEELETRLHSQITERRDEIERQMKLTE
TLTNEHKHTKRSVIEIEQEAKNELLEKEVLDEDEKDGDAKSESQSIEGTKKQEECKMVTR
QKSNQLTNGTLHFKLGMEQGFKNYVNQYSTNPIALNKPQRNEERDKRRHLSHKFSLTTAS
DFKWIGITMGTTDNMITTLRQTLINFESNIAASFLNINWVVNKKIWNAAVMNARRPSEFA
VVLLLFQASLKSVVFANVWHEQLGHTTLQRITSAEREERKKLEKREKRERDDEEERNRLA
FNYIKYTLGLKHQVWKQKGEEYRVHGQWGWLWLSSSRRCGVRARRAQPLTHNRVYVHYTM
GEENDVNEIILVDPRTQRFMQQCESSNVDGQVCHYLPDQYKNVKVIEDVTEKIKGHIDVS
KALNAPGRTYYSKVARKSRLDDLLDRRLKLAEVEEQMASKIPSDMKPLLVSSQNNTANSK
QTFLEKRLLRLTEVQAKGGPANVNLELVNSLAKQIQTVRLQFSQLNRFAKVFRCYTKECN
TNSNAVSQITQNTCYSPLCLQKARAKKELLLLLRKAHTAGNGSKETVAAILGAVKKPSIL
EQKLTEGKRESTQVAVDDSEEGKPAESEAPLDLLQDWEHARAHAVPFSDSLLTECILVDQ
ECVTNTKIKQEVNASSGCNTTPDSNTQDSDKIDYIESMDVCSNVEIESTEDSIVTGLNSG
NAEDVDMTPGWRRKRNQKSKKSYIGTKDVLDQTLDKDIPLNKQNRRFPITARPVKRECVK
KYERETFENGNERVYSTSSPRGRVYLLNDAAKLYEQAVKTEDKSTITKKPSYSRYPLISN
FLTHKKKRSLLVLPRFELLKLARLGGKSSTNGFHHAAKNNTIWQYQCSRPLFRTCWSYRT
SNATSLSSLALQLRILWSCLRWDDMIAKPPSTDGKHQVTTDTEIVTLELLKLRHSGRYGE
KTSYLRRKVVIPLEMPKTVREVTSIRSGLRKRKRAESPQPTEPQITEEWVDEDKLELWEI
KFMGEKQEKARLSAVTRSVASRQLEASGSNGSNTSTNGALGVAGRVQLAPKLSEDVKEKM
EQQLKLQRAVHQQRKLVATGEITRSVTPVKGQVIGSRRVIVKNPDGTTRIIQQAVTQVSR
TGGANTAAAAASPTVGGSTSTQSNPSTSTPHKVQIIRGPDGKVSVRGLNPGQQLVQMPDG
KLHVLTTTTSSNSAGQGNKMKVPIKPASTSSSPAISSAQTTTNPVTPVIKQIAVKHVTKN
SATQSIASSSRVALPLAQIKNKLLLAQQQQQSTSSSPATSSSPVQKIVSKVVNTSTSGQT
LQQVFVQSGSKLVVGQNAQGQKVIISTSAAQQQGTSPVQQQQLVQSQPIQQSPQQISMTQ
VGNQPTQKVIQQIVNTSNVQQQIVVGGQRIILSPGQTIVTQRNVPQSQALQMVQQQIQTQ
QQQQQHHVVQPQQQFVVQSNQIVQSSPSAQTKLVKQLVVQQQSQQTIEEKTQITTTDSNE
TGTQQVLVPNSTLAQQLAQGKLQVATVNGQQVIVKPLGNNQAQIVAHIKHQGDGNAHIVT
SNSATAVPQANPQTSPVKQQALPPQSPQQVVVQQQQIHQQSPTNFESGVTPITQQPVLTQ
AVQAPAQQQALSVEESLLQNQPPGTVIKCVTAQVLQTEHGPRIVLQGLVGNDFTAQQLQL
VQTQVKQQLMKAQESNGKLGVLGPTKIYLAVQPENAVQSQPPPLTPVHQSAAHQQTNNIE
IDADTLATTYEANSTIKDIAINNGDDQENSKCAETENSNITTNESFAGTSSLLEGSEHDE
PTNLAGLDISETDLENKQNESFVVTRGYIQKSISNALKQGNLSPELEEKLVCMQKQQENA
NSTNEWETCSRGSVNEEALTPSRQTDDTEWKIRTSLRRPNAMTTSSQFNRILKKNRSKND
EVAELGEQKQSQLERHKELLKKNILRKRSLLERNLQSEIHEDVKTKVQRHVRPLSNASPD
EQSENERSGEPNLDFKRTEVQNPRHGAGRPKKLTRKKEKLYCICRTPYDDTKFYVGCDLC
SNWFHGDCVSITEEASKKLSEFICIDCKRARETQQLYCSCRQPYDESQFYICCDKCQDWF
HGRCVGILQSEAEFIDEYVCPECQRKNDANAANMKKLTSNDVEELKNLIKQMQLHKSAWP
FMEPVDPKEAPDYYKVIKEPMDLKRMEIKLESNTYTKLSEFIGDMTKIFDNCRYYNPKES
SFYKCAEALESYFVQKIKNFRENVFDQRT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]