dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

NP_926781.1.44878 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein glr3835 [Gloeobacter violaceus PCC 7421]; AA=GCF_000011385.1; RF=reference genome; TAX=251221; STAX=33072; NAME=Gloeobacter violaceus PCC 7421; strain=PCC 7421; AL=Complete Genome; RT=Major
Sequence length 111
Sequence
MRSPLPPMPDPEAFPPGAVSVDAGGITLTVWAQPRASCSEVVGWQQNAFKVRLAAPPVEG
KANAECVALIAAFFGVPRRQVSLVQGQQGRHKKIRIEAPADLLLVALQKLS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]