dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

NP_975512.1.55851 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein MSC_0528 [Mycoplasma mycoides subsp. mycoides SC str. PG1]; AA=GCF_000011445.1; RF=reference genome; TAX=272632; STAX=2102; NAME=Mycoplasma mycoides subsp. mycoides SC str. PG1; strain=PG1; AL=Complete Genome; RT=Major
Sequence length 285
Sequence
MNANLNIDQLDNLINQNDSLIIAIGSEIYQTDNQIEFENNFSDFIKEFNFIDFKQASVYP
FLDIKNYWAFFSRYIKLNYFDQKLDNSFIDLKNYLENKNYFIITTNRDNSLELAGFDLNK
IFYLDSKLNLLECSKKCSEELYINDDAILNMANNQKNLKVELEQIPVCKKCNSYLKVHQR
FWCQVFIKDDEFLQTQNNYQKFINQNKDKKMLFWEIGINFNNQLTVKKPFWQMIEKFDKA
TYLTMNKKIYRIPLEIRSKTITYTNDLNLVIKNLEEVKNGTNRTN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]