dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_000482749.1.11296 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: fimbrial protein StfD [Shigella]; AA=GCF_002174725.1; RF=na; TAX=623; STAX=623; NAME=Shigella flexneri; strain=FC1846; AL=Contig; RT=Major
Sequence length 250
Sequence
MFNLTNTAKIVVPALALLATAVSFSSHASVTPDRTRLVFNESDKSISVTLRNNDPTLPYL
AQSWIEDAKGNKISSPLAVLPPVQRIDAMMNGQVKVQGLPDINKLPADRESVFYFNVREI
PPKSNKPNTLQIALQTRIKLFWRPKALENTSMKSPWQHKVTLIRNGQDFTVNNPTPYYVI
ISNASAKKGGNPPAGFTPLMMEPKTSAPLNAKMDSVPVLTYINDYGARMPLYFKCTGNSC
QVDEEQSRKG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]