dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_000726578.1.13299 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment methionine gamma-lyase [Bacillus cereus]; AA=GCF_001044825.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=NVH 0075-95; AL=Scaffold; RT=Major
Sequence length 392
Sequence
MKKKHMETALIHHGYTSEAHKGSLTPPLFQTSTFTFETAQQGEASFAGVDPSYIYSRLGN
PTVKLFEERMAVLEGGEEALAFGSGMAAISATLIGFLKAGDHIICSNGLYGCTYGFLEVL
EEKFMITHSFCDMETEADMENKIRPNTKLIFVETPINPTMKLIDLKQVIRVAKRNGLLVI
VDNTFCSPYLQRPLELGCDAVVHSATKYIGGHGDVVAGVTICKTKALAEKIRPMRKDIGG
IMAPFDAWLLLRGLKTLAVRMDRHCDNAEKIVSFLKNHDAVEGVWYPEGELASRQMKRGG
GVISFSIKGGKEETQAFINDLHFITIAVSLGDTETLIQHPATMTHAAIPAALRQEMGIYD
NLIRLSVGLESWEDIVSDLEQALKKISTVSNQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]