dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_000779966.1.34158 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: membrane protein [Bacillus cereus group]; AA=GCF_001758315.1; RF=na; TAX=1392; STAX=1392; NAME=Bacillus anthracis; strain=PFAB2; AL=Contig; RT=Major
Sequence length 240
Sequence
MKLVIPKQHGAWAMLVIPFLLSVILGKPTIYHIPLFIAWFFIYLATYPFLMYIKQKRKKE
YLHAAIVYFIIAFVFGMISLLYEWRILLFVAVMIPFFIVNMYYARQKNERALLNDISAII
VFCIGGLVSYYFSMKLIDKTALFIALISFLYFLGSTFYVKTMIREKNNPKYRFISWGYHI
VLTVIVFAINPLCSLIFIPSVIRAIILYGKKISIIKVGILEIVNSVYFLIITAIIMKYAI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]