dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_001540416.1.22270 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment fimbrial assembly chaperone protein StcB [Salmonella enterica]; AA=GCF_002065955.1; RF=na; TAX=28901; STAX=28901; NAME=Salmonella enterica; strain=BCW_2657; AL=Contig; RT=Major
Sequence length 250
Sequence
MLLTNLFNRRRSSPVFYKQGRVNMKILSAVLLSAIILPAHAGIVIYGTRVIYPAEKKEVV
VQLVNQGEQASLVQSWIDDGNTSLPPEKIQVPFMLTPPVARVAAESGQQLKIKKMPNSLP
DNKESLFYLNVLDIPPNSQENAGKNVLKFTMQNRIKLIWRPSRIAAVTKDSFQRIGLFRS
NKTVIMKNDTANWITVTDVKAGNTKINDQTIMLPPLSTQNINMKYASTSQYEVTIIDDNG
NYISSKINVK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]