dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_002657853.1.86244 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 50S ribosomal protein L11 [Borreliella burgdorferi]; AA=GCF_000172335.2; RF=na; TAX=498740; STAX=139; NAME=Borrelia burgdorferi 64b; strain=64b; AL=Contig; RT=Major
Sequence length 143
Sequence
MAKKKAISWIKLQVPAAQAAPGAKIGQALGPHGVSGPQFVKEFNERTAKMDPGIVVPVII
TVYSDKSFSFIVKTPPASILIKKAIGIESGSKKSNTDKVGTISKEKLMEIARIKMSDLNA
KSESAAFKIIAGSARSMGVEVEK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]