dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_002759883.1.50331 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment acetolactate synthase large subunit [Microcystis aeruginosa]; AA=GCF_000312265.1; RF=na; TAX=1160285; STAX=1126; NAME=Microcystis aeruginosa PCC 9809; strain=PCC 9809; AL=Scaffold; RT=Major
Sequence length 550
Sequence
MGELNTAELLVKCLENEGVEYIFGLPGEENLDVLEALKNSSIKFITTRHEQGAAFMADVY
GRLTGKAGVCLSTLGPGATNLMTGVADANLDGAPLVAITGQVGTDRMHIESHQYLDLVAM
FAPVTKWNKQIVRPGITPEVVRRAFKTAQSEKPGAVHIDLPENIAAMAADGHPLPLDSQE
KVYASYRTLNMAAAVISKAKNPLILAGNGAIRANASEALTEFATALNIPVANTFMGKGVI
PYTHPLALWAVGLQQRDLISCAFERSDLIIAVGYDLIEYSPKKWNPDGKLPIIHIGMTPA
EIDSSYAPVVEVVGDITDSLIDILKRADRQNKPTPVTAGLKTEIRADYETYANDTGFPIK
PQKLIYDLRQVMGPEDIAICDVGAHKMWMARQYHSDCPNTCIISNGFAAMGIAIPGAIAA
KLVYPNKRIVAVTGDGGFMMNCQELETALRVGTPFVTLIFNDGGYGLIEWKQLNYFGTSS
FIKFGNPDFVKFAESMGLKGYRVESTQDLIPTLEEAFRQEVPTVIDVPVDYGENLRLSQK
SGDLSCQIWE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]