dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_002763152.1.24258 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phosphohydrolase [Microcystis aeruginosa]; AA=GCF_000312165.1; RF=na; TAX=1160286; STAX=1126; NAME=Microcystis aeruginosa PCC 9717; strain=PCC 9717; AL=Scaffold; RT=Major
Sequence length 198
Sequence
MRQQVIDWLKENVNEHRLRHILGVETMCIDLARHHDLDPVQAGQAGLLHDLAKFFKPKKL
LKMAESAGIDVDNICLSHPHLLHADVSAVVAQKEFNVTDEEILEAIRNHTLGKPNMSDLS
CIVFIADALEPNRGDTPELNALRQLSYQNLHKSVQQTCDYSLKYLLSSHCPIHPRTVLTR
NWALQIVKEQPTETKTID

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]