dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_003026590.1.5563 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment aspartate 4-decarboxylase [Francisella tularensis]; AA=GCF_000305895.1; RF=na; TAX=1210521; STAX=263; NAME=Francisella tularensis subsp. tularensis 831; strain=831; AL=Contig; RT=Major
Sequence length 528
Sequence
MSQQDLSPFEFKDELIKLATSKADRLMLNAGRGNPNFLATIPRHAFLRLGDFALRESERS
YSYLNNVFGGLPEKKGITERFDYYCLAHDKQDGIDFLRAAISFVDDYLGINKEEFLYEMT
NAYLGCDYPSPPRILPIIEKIVMHYLREELYQNIDTPLEFDIFATEGGTAAMTYIFQSAK
INGLLNAHDKIAMITPIFSPYLEIPELPEYNNPIVHIYADEKVHWQVTDKELEKLLDPTI
KILCLVNPSNPPSVKISDLVLEKIAYIIDNHRSDLMIITDDVYATFSDDFESLFSKCAYN
TLCVYSFSKYFGATGWRIGTIALHKDNIFDKLISNLDDKKLDELDKHYSSLTTDSRTLKF
IDRLVADSRSVALNHTAGISLPQQLQMGLFALSSLLDNQNIYRKEAKDLIRRRYNILYSS
ISPKLQQSLDENNVGYYTLLDLEELSYKIYDKDFSQWLIKNHSGPETLKILATETGIVLL
PGKGFDVLHPSARVSLANLREYDYRQIGISIRQQLDNLYSQYKKQTKD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]