dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_003178196.1.74244 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: RidA family protein [Bacillus]; AA=GCF_000008425.1; RF=na; TAX=279010; STAX=1402; NAME=Bacillus licheniformis DSM 13 = ATCC 14580; strain=DSM 13; AL=Complete Genome; RT=Major
Sequence length 125
Sequence
MTKVVQTKEAPAAIGPYSQGIVVNNMFYSSGQIPLTPSGEMVTGDITEQTHQVFRNLKAV
LKEAGASLETVVKATVFLADMNQFTEVNEVYGQYFDTHKPARSCVEVARLPKDALVEIEV
IALVK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]