dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_003513365.1.6636 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glycosyl hydrolase [Ruminiclostridium thermocellum]; AA=GCF_001692755.1; RF=na; TAX=572545; STAX=1515; NAME=Ruminiclostridium thermocellum DSM 2360; strain=LQRI; AL=Complete Genome; RT=Major
Sequence length 947
Sequence
MKTGFSTVKKVQVIFLIICMITSIIAVPSYVSAEPEYNFAKALQLSLYFYDANKCGEGIT
GGRLEWRGDCHLEDKEVPLIPMTEDYFGTNMSQEYIDKYRHIFDPDGDGTVDLSGGMHDA
GDHVKFGLPGTYAASTLGWGFYEFREAYEKVGVDDHAKEILRWFNDFYLKATFLDEDGNV
IAYCYQVGEGNIDHNFWNPPELQSSKVLDLFARPAYFATPETPASDQCAGAAASLAINYL
NFKDEDPEYAQRCLDTAIALYEFAKKYRGLGESGGFYGSSYDHDELAWAAVWLNIATGDM
QYIDDIVATDSEGNYIGYMQRIIKDTTNTWQNIWVHCWDTVWGGVFAKLAPITNTERDWY
IFRWNLEYWSGIPHENPNDTTFLAKSPGGFSVVNAYGSARYNTAAQLCALVYRKYTGRSD
FADWAKSQMEYIMGNNPMNRCYIVGYSENSAKHPHHRAAHGSKTFSMLDPEEHRHTLWGA
LVGGPDLDDFHVDETTDYVYNEVAVDYNAAFVGACAGLYYYYGEALGHKPVPNFPPKEEA
VEEYYVEGKIEQENKERTQVTIKIFNDTCHPPRFETGLMARYFFNISELLDAGQSIDDVK
IEVYYDENKASYDGPAEVRGPIKYDDAGTYYVEVDWSGRIIYGKREIQLALISSLDSNYK
SNWNPENDYSREGLGKEFVRTEKIPLYLNGVKVFGNEPPQIEPSPTPSDGPGSTPPPSQK
PSLEVLYKYGDTTAATKDIRGSIKIKNTGTKPVNLSDVKVRYWFTKDGASSQEFVCDYAH
LSESMITAKFVDLENPVENADNYLEIGFDSNAGILGPGSDTGEIQFRIVKGDYESYDQSN
DYSCMATAKDFTANPNITAYVNSVLVYGNPPVDEEEEIEIVYGDLNGDGRVNSTDLLLMK
KRIIREIDKFNVPDENADLNLDGKINSSDYTILKRYVLKSIEKLPVK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]