dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_003514882.1.60145 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment carbohydrate-binding protein [Ruminiclostridium thermocellum]; AA=GCF_000173015.1; RF=na; TAX=492476; STAX=1515; NAME=Ruminiclostridium thermocellum JW20; strain=JW20; AL=Contig; RT=Major
Sequence length 630
Sequence
MRKLRKLLLFSTVLFVVFTQLFGFIITVDAAETATINLSAEKQVIRGFGGMNHPVWISDL
TPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVFASPWNPPSNM
VETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWT
PQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNM
PYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIR
RSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSAYKNKKDNSVVAVV
INKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFVG
GGSSEPQIPVERNAFSKIECEEYNATNSSTVQVVGTGTGSGLGYIENGNYFAYKNINFGN
GANSFKIRAATTGTPKIEIRLGSPTGTLAGTLQVAATGGFNAYEEQSCSINKITGVQDVY
LVFGGAVNVDWFTFESKQEPTFKYGDLNGDGNVNSTDSTLMSRYLLGIITTLPAGEKAAD
LNGDGKVNSTDYNILKRYLLKYIDKFPVES

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]