dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_003515342.1.19387 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glycoside hydrolase [Ruminiclostridium thermocellum]; AA=GCF_000184925.1; RF=na; TAX=637887; STAX=1515; NAME=Ruminiclostridium thermocellum DSM 1313; strain=DSM 1313; AL=Complete Genome; RT=Major
Sequence length 961
Sequence
MTDSPQKRILKRKNRCKGIITAVIIAAQLLTSSILFAEAPPATFTPAENWEDYDYFNFAE
ALQKSLYFYDAQKCGVEAGYDHGGRLEWRGACHEVDERIPISNTSLSEAFLAKYRHIIDP
DGDGTVDVHGGFHDAGDHVRFGLPQSYTAGTLGWGFYEFRESFRAIGEEEHMIEILRYFT
DTFLRCSFMDEEGNIVAFCYMVGEGDEDHCYWGPPELYPEEYLRSRPADFATFDDPGSDV
CASTAAALCTSYLNFKDEDPEYAEKCLTVAKALYDFAVKYRGLHKGDGYYTSDYDEDELA
WAAVWLYECTGDMKYINDIVAVDETGNYVGYMKRIIPDTFKQNVWYNSWVHCWDAVWGGT
FIKLNELFPENELFDFIARWNVEYLSGGKCPHEDPNDHNYCKPSPAGYTMINGWGSARYN
AAAQLCALVYMKNNPDRTDFGEWAKSQMEYLMGRNPMGYSYIVGYGYEKGLPFAKHPHHR
AAHGSKTNSMNDPEEHRHILWGALVGGPDLNDYHIDSTTEYAYNEVAVDYNAAFVGALAG
LYKYYGQGHEPIPNFPPLEPETDDYFCEAKIVRETKDSTQVLLRIHNESTRPPHYETGMM
ARYFFNISELIENGQSIDDVIFTIEYDEQISMQQEPVVYRGPFKWDDAGTYYFEFDWSGR
KIYGDRELQISFRVKQDSNYMTHWDSSNDYSRQGLTNEYAISKNVPVYLNGVKVYGEEPP
KLSPTPTPTIDPSQTPDANASISVSYKCGVKDGTKNTIRATINIKNTGTTPVNLSDIKVR
YWFTSDGNEQNNFVCDYAAFGTDKVKGIVKKIENSVPGADTYCEISFTEDAGRLAPGGST
GTIPFRIEGAAEYDQTDDYSYNSEMSDDFGDNTKITAYIKDKLKYGVEPVTIIDITLGDL
NYDGKVNSTDYLVLKRYLLGTIDKESDPNFLKAADLNRDGRVNSTDMSLMKRYLLGIITS
F

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]