dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_003517920.1.16390 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment cellulosome anchoring protein cohesin region [Ruminiclostridium thermocellum]; AA=GCF_000493655.1; RF=na; TAX=1349417; STAX=1515; NAME=Ruminiclostridium thermocellum BC1; AL=Contig; RT=Major
Sequence length 263
Sequence
MNGVHMMKKWLCILVIVVLASTCLIAYAAEANQWTALRATFKVFVKGEEFKSQDPIVAIN
GRTYLPLKAIGDVLGVDVVWNEGLRRVEVAMSENQNGDKPDVAPVVAIHEAETADYILDV
LVEGVKAKAGDTVEIPLKFENVPSHGIQSFNLSLYYDSKAIEVLKVEPGSIITDPANNFD
YNIVYKDSEIVFLFDDDKQKGEGLIKTDGVFAKLTVRIKPDIFKDSGATKKYSLITFGES
NFCDFDLKPILAVLKEGKVEIEK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]