dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_003520229.1.31213 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glycoside hydrolase [Ruminiclostridium thermocellum]; AA=GCF_000015865.1; RF=representative genome; TAX=203119; STAX=1515; NAME=Ruminiclostridium thermocellum ATCC 27405; strain=ATCC 27405; AL=Complete Genome; RT=Major
Sequence length 580
Sequence
MILLATSVCYSSNPSITQASTGADGAIAKLQSYNYSHMYIRNANFDVRIDDNVTPETDAQ
WVLVPGLANSGEGYVSIQSVDHLGYYLRHWNYDFRLEKNDGTRIFAEDATFKMVPGLADP
SYTSFQSYNYPTRYIRHYNYLLRLDEIVTALDREDATFRVIDSSSVDPDKADDSVIVTNP
IVRRRADPWVYRHTDGYYYMTASVPEYDRIELRRSRTLQGLSTATPKTIWRRHSSGIMGG
HIWAPEIHFIDGKWYIYFSAGTSTNYFDIRLYVLECSDSNPLTGTWVEKGQLKTNWESFT
LDATTFEHNGTRYLVWAQKDPKIASNSNIYIAKMNGPLAITGNQVMISTPEYSWEKIGYA
VNEGPAVLKKNGKIFITFSASATDANYCMGLLTASDTANLLDPKSWHKSPNPVFQSNPST
GQYGPGHNSFTTSPDGKVDIMVYHARNYRDITGDPLYDPNRHTRAQIVNWNADGTPDFGI
PVADGTNVIYIPPQTPTPIPTNSPTPSDLIYGDINGDNSVNSTDLTILKRYLLGSTVPTA
PNWRLAADLNLDGNINSTDFTILKRYILGRIEAPPWVNQT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]