dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_003704358.1.54215 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MarR family transcriptional regulator [Lactobacillus salivarius]; AA=GCF_000143435.1; RF=na; TAX=712961; STAX=1624; NAME=Lactobacillus salivarius CECT 5713; strain=CECT 5713; AL=Complete Genome; RT=Major
Sequence length 115
Sequence
MPVDTENKYTLCPKFTKTFGILGRKWNGLIIEVLLEKGPQRFRNLADSVDKCSDRVMVER
LKELEDEGLVERMAQPGSTRVLYKLTPQGEDLKEIMSDIHKWSDKWYSVEDCANS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]