dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_004216472.1.6702 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase S8 [Natrialba magadii]; AA=GCF_000337875.1; RF=na; TAX=547559; STAX=13769; NAME=Natrialba magadii ATCC 43099; strain=MS-3; AL=Contig; RT=Major
Sequence length 683
Sequence
MQPERRDTRSRRSILRGAGAVGGLIGATGLSSATPGRSPGPKQTELLVGINDEYARSSAN
GTERTAREAVPADATVVHSNEQLEYVAIEVPAELPSEAVEHVRDVLDSNDAIEYVEENAT
LQSLYTPNDPYYDSQHAPQQVNCEDAWAETLGDEDVTIAVVDQGVEYEHENLSGNVDDRI
GEVFVGRGSDPGPLSRGDTHGTLVAGIAAGETGNGTGQAGISNCSLLAARALDEQGQGAL
SDIADAIQWAADEGVDVINLSLGSSSGLWTLENACEYATERGCLVVAAAGNSGGSVMYPA
AYDDVLAVSALTSRDRLASFSNRGPEIDLAAPGQNLLSTTLNDGYDRISGTSAAAPVVAG
VAGLVRSVYPGLSSSALREHLRETAVDVGLRSAAQGAGRVDAGNAVTTVPEGYDGPDERD
GDTDEDEEDDEDDEETDTDGHLLSFVTEPEASFADYEFTATGPVEFTTAPGQTPSGGTIE
GGTYAAEDYIEEDDETWHAGGVTGGGQGDAFSVEGAITSIEVGQPDVMWVELDGERLSPE
EVIEETTGDDTDETDGGEEDESDETDETDEPQCGDETNTARVEGDLDGSGWWPDTARWQY
TPQTENPCELTLTVDGPSGADVELYMTRDGRRPTQWDADESATATGDTQSLTTALESDDT
VRILITATGGSGTYELEIVEQGY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]