dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_004219358.1.38998 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment xylose isomerase [Bifidobacterium animalis]; AA=GCF_001263985.1; RF=na; TAX=1365954; STAX=28025; NAME=Bifidobacterium animalis subsp. lactis ATCC 27674; strain=ATCC 27674; AL=Scaffold; RT=Major
Sequence length 450
Sequence
MAGLWDIDKIEYVGRTKGLQEGLGFQYYDADKVVAGKKMKDWLRFGVAWWHTFDAPLTDP
FGDGTAQRPWDGKYSDPMDNALAKVDYAFEFFTKLGAEYFCFHDRDIAPEGDTLRETNAN
LDRVVDKIEENMQSTGVKLLWNTSSLFTNPRFVAGASTSPFADVYAYAAAQLKHSLEIGK
RLGAENYVFWGGREGYENLWVTDMKREQEHMAKFFHMCADYAKQIGMDAQFLIEPKAKEP
TTHQYDFDAATACNFLRAYDLIDVFKLNLEGNHANLAGHTYQHEIRVARDNGVLGSLDAN
QGDMLLGWDLDEFPTNLYETTSVMWEVLDEGQIGPHGGLNFDAKPRRTSFSAEDLFRAHI
AGMDSFAAGLLVADKMHQDKYIEDLVANRYGSYDSGIGKSIDDGTATLESLNDYAIDMPQ
SEIIASTHPDHLEDVKATINNYIIDALANA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]