dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_004594978.1.94779 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: cell division control protein Cdc6 [Haloarcula]; AA=GCF_000336615.1; RF=na; TAX=1227452; STAX=396317; NAME=Haloarcula amylolytica JCM 13557; strain=JCM 13557; AL=Contig; RT=Major
Sequence length 414
Sequence
MGMFERDTEIYLDRDALREDYQPENLVGRDTELNRYRAALQPVINGEQPNNIFLYGKTGV
GKTAGTRYLIDHLEEDAAKYEDIDLTVKMLNCDGLSSSYQIATRLVNEFRDETSQISTTG
YPRATVYDMLWTELDSCGGTIYIVLDEVDHIEDDSILYQLPRARANDNLSSAKIGIIGIS
NDFSFRDDLSPKVKSSLCEEEIQFPAYDAKELIQILQQRADVAFHDGVLEDGVIELCAAY
GAKDAGDARQSLDLLMKTGDLARDKDTDTISEDLVREARDVLERGRIQEGISGLTQHGHL
VVYAMVTLDQEGKTPARTRDIRPRYTNFAEKAGIDPLVPRRMRDHLGELSMLGIISAIER
NEGRRGGTYREYSLEMDPEMILAALEKTVDDVGIHKSVTNLVDSEATLSDFQST

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]