dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_004998383.1.29537 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: transcription termination factor Rho [spotted fever group]; AA=GCF_000023005.1; RF=na; TAX=347255; STAX=35788; NAME=Rickettsia africae ESF-5; strain=ESF-5; AL=Complete Genome; RT=Major
Sequence length 458
Sequence
MNTTNKESTAELNNTESNNNYNNFAENGNIINLKQLKRKLPEELQAQAEELKIENINSLL
KQELVFAILKKSVEQGVLIVGEGVLEVLPDGFGFLRSPEVNYLAGPDDIYISPSQIRRFG
LRTGDTVEGQIRAPKAGERYFALLKVNRVNFEDPSKAYHRVHFDNLTPLYPDEKLGLELE
NNSKDSKDFSTRVIELVAPMGKGQRALIVAPPRTGKTVLLQNIAHAITTNNPEVFLIVLL
IDERPEEVTDMQRSVRGEVVSSTFDEPASRHVQLAEMVIKKAKRLVEHKKDVVILVDAIT
RLARAYNTVVPSSGKVLTGGVDANALQRPKRFFGAARNIENGGSLTIIGTALIETGSRMD
EVIFEEFKGTGNSEIVLDRKIADKRIYPAIDITRSGTRKEDLLVDKIILNKMWVLRRIID
PMGSSEAIEFLLKKLENTKTNGEFFEMMKSPERPKNGL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]