dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_005740914.1.55113 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: hypothetical protein [Pseudomonas]; AA=GCF_000145745.1; RF=na; TAX=629259; STAX=47877; NAME=Pseudomonas amygdali pv. morsprunorum str. M302280; strain=M302280; AL=Scaffold; RT=Major
Sequence length 888
Sequence
MKSLPPKQSRARSVVFAEGAQWIRADFHLHTRADREFKYTGDDNFYHSNYVDALEKASIR
LGVITNHNKFDLDEFKALRKTAQNKGIALLPGVELSVNDGANGIHTLVVFSDEWIDEHDH
INPFLTSAFEGKTPAQYEQENGRSSWSLLETIKKLESYHRDFFLVFAHVEAPSGLWAELD
GGRLTDLGQNEFFRRRTLAFQKVRTHDGAGKDKPCRTKIQSWLQSWYPAELEGSDPKGID
EIGRGKTSYLKLGELSFGAVKFALGDPAARVAMEPQKHKASHIRSIHFDGGILDGQTLHF
SSELNALIGIRGSGKSSLLEAVRYALDIPRGEKVQDTKYKDELIRHTLGSGGKVTLTACD
IYGQEFTISRIFREAPNVYLGGTLQPGVSIRETVLRSPIYFGQKDLSSTGEGFETDLVEK
LVGEKLRVLREAIETQRQRVCEAAQRWLKLSNIAETKRDFNAQLTDANFRLKKFEEYGVA
DKLQKRLGFQQDATALARMAERADDFILALGSLIAEHEDELRNATSYVSKQNPDFFVAYN
AEFSNLVAGVDQLKQIEQDMRAVAARLGTKQYEFEGASKSLQEEFAQVERQLAQELKQTG
MTAIQPDDFLAQQQRKTKAEQMLDALAKQESQQTTIRDALFAEIDKLNELWLREFTTIKT
ELDRVNAVNTALQIEADFKGDKEAAISFMQQLFKGSNIRETTLRAVMEDYADFGGLLRSL
PGALVKAGSAPEVFEKTFMQYLVEFSAWQVPNRFVIRYRGKELRHHSLGQRASALLLYVL
SQRQNDVIIIDQPEDDLDNQTIYDDVIKLLREMKPHAQFIFATHNANFPVLGDAEQVHAF
QYQDEKVATQSGSIDAHPVQEAIINIMEGGQEAFNRRKEVYNLWKLQS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]