dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_007053280.1.54925 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment cystathionine beta-lyase [Bifidobacterium longum]; AA=GCF_900157155.1; RF=na; TAX=216816; STAX=216816; NAME=Bifidobacterium longum; AL=Contig; RT=Major
Sequence length 89
Sequence
MGVDFRTQAIHAGYEPLDNGRAAVPPIYASAAFDLGDAARGDALAGGDIDGFEYSRVANP
TVDALEKRLAALEDGIGAVAVGSGMAAAY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]